Recombinant Proteins

Recombinant Proteins
Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.
Conjugate
- (158)
For Use With (Application)
- (152)
- (152)
- (6)
Recombinant
- (158)
Form
- (152)
Species
- (152)
Keyword Search:
potassium
Clear all selections
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.

1
–
15
of
202
results
Novus Biologicals™ Recombinant Human Sodium Potassium ATPase Beta 1 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results. Applications: SDS-Page
Conjugate | Unconjugated |
---|---|
Molecular Weight (g/mol) | 30.4kDa |
Storage Requirements | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
For Use With (Application) | SDS-PAGE |
Source | E.Coli |
Name | Human Sodium Potassium ATPase Beta 1 Protein |
Regulatory Status | RUO |
Purification Method | >90%, by SDS-PAGE |
Gene Alias | adenosinetriphosphatase, ATP1B, ATPase, Na+/K+ transporting, beta 1 polypeptide, Beta 1-subunit of Na(+), K(+)-ATPase, MGC1798, Na, K-ATPase beta-1 polypeptide, sodium/potassium-dependent ATPase beta-1 subunit, Sodium/potassium-dependent ATPase subunit beta-1, sodium/potassium-transporting ATPase beta-1 chain, sodium/potassium-transporting ATPase subunit beta-1 |
Product Type | Recombinant Protein |
Gene ID (Entrez) | 481 |
Formulation | 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 0.4M urea |
Immunogen | MGSSHHHHHH SSGLVPRGSH MGSEFKPTYQ DRVAPPGLTQ IPQIQKTEIS FRPNDPKSYE AYVLNIVRFL EKYKDSAQRD DMIFEDCGDV PSEPKERGDF NHERGERKVC RFKLEWLGNC SGLNDETYGY KEGKPCIIIK LNRVLGFKPK PPKNESLETY PVMKYNPNVL PVQCTGKRDE DKDKVGNVEY FGLGNSPGFP LQYYPYYGKL LQPKYLQPLL AVQFTNLTMD TEIRIECKAY GENIGYSEKD RFQGRFDVKI EVKS |
Cross Reactivity | Human |
Recombinant | Recombinant |
Novus Biologicals™ Recombinant Human ATPase Na+/K+ beta 3 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
Purity or Quality Grade | >80%, by SDS-PAGE under reducing conditions and visualized by Colloidal Coomassie™ Blue stain |
---|---|
Conjugate | Unconjugated |
Gene Alias | ATPase, Na+/K+ transporting, beta 3 polypeptide, ATPB-3, CD298, CD298 antigen, FLJ29027, Na, K-ATPase beta-3 polypeptide, sodium/potassium-dependent ATPase beta-3 subunit, Sodium/potassium-dependent ATPase subunit beta-3, sodium/potassium-transporting ATPase beta-3 chain, sodium/potassium-transporting ATPase subunit beta-3 |
Common Name | ATPase Na+/K+ beta 3 |
Molecular Weight (g/mol) | TMW: 27.4kDa |
Gene ID (Entrez) | 483 |
Formulation | 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol, 0.15M NaCl, 1mM DTT |
Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
Concentration | 0.25mg/mL |
For Use With (Application) | SDS-PAGE |
Recombinant | Recombinant |
Novus Biologicals™ Recombinant Human KCNMB3 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More

Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results. Applications: SDS-Page
Purity or Quality Grade | >85%, by SDS-PAGE |
---|---|
Conjugate | Unconjugated |
Gene Alias | BK channel subunit beta-3, BKbeta3, HBETA3, KCNMB2, KCNMBL, potassium large conductance calcium-activated channel, subfamily M beta member3, slo-beta-3, subfamily M subunit beta-3, voltage and Ca2+ activated potassium channel Maxi K beta 3subunit |
Common Name | KCNMB3 |
Molecular Weight (g/mol) | TMW: 16.8kDa |
Gene ID (Entrez) | 27094 |
Formulation | 20mM Tris-HCl buffer (pH 8.0) containing 0.4M UREA, 10% glycerol |
Storage Requirements | Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles. |
Concentration | 1mg/mL |
For Use With (Application) | SDS-PAGE |
Recombinant | Recombinant |
Invitrogen™ Human KCTD9 Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | NCDLCGCDLQEANLRGSNMKGAIFEEMLTPLYMSQSV |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human KCTD9 Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human KCTD8 (aa 364-427) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | SEASTPQDNPSSAQQATAHQPNTLTLDRPSKKAPVQWIPPPDKRRNSELFQTLISKSRETNLSK |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human KCTD8 (aa 364-427) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human KCTD15 (aa 1-45) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGI |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human KCTD15 (aa 1-45) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human KCTD14 (aa 87-170) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | RPILDYLRTGQVPTQHIPEVYREAQFYEIKPLVKLLEDMPQIFGEQVSRKQFLLQVPGYSENLELMVRLARAEAITARKSSVLV |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human KCTD14 (aa 87-170) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human KCTD1 Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | LGNTYILPKDSQVGPDVKSEAAPKRALYESVFGSGEICGPTSPKRLCIRPSEPVDAVVVVSVKHDPLPLLPEANGHRSTNSPT |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human KCTD1 Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human KCTD14 (aa 2-81) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | WQGCAVERPVGRMTSQTPLPQSPRPRRPTMSTVVELNVGGEFHTTTLGTLRKFPGSKLAEMFSSLAKASTDAEGRFFIDR |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human KCTD14 (aa 2-81) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human KCTD4 (aa 90-164) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | LNFLRNGELLLPEGFRENQLLAQEAEFFQLKGLAEEVKSRWEKEQLTPRETTFLEITDNHDRSQGLRIFCNAPDF |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human KCTD4 (aa 90-164) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human KCTD1 Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | SKSSLISIRSSLNRYLNEPPYCRTLDLTKDPELRSANLTLAAVIRKLEEQGAGPVVQKQAITRADLRKLYTSSVFSTNTPFGLLNKVWFETCMY |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human KCTD1 Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human KCNK7 (aa 33-92) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | GPPACRLQAELRAELAAFQAEHRACLPPGALEELLGTALATQAHGVSTLGNSSEGRTWDL |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human KCNK7 (aa 33-92) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human TMEM175 (aa 160-186) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | YAFHFPHLLSPQIQRSAHRALYRRHVL |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human TMEM175 (aa 160-186) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human KCTD16 (aa 116-186) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | PDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSLLPADRKWGFITVGYRGSCTLGREGQADAKF |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human KCTD16 (aa 116-186) Control Fragment |
Recombinant | Recombinant |
Invitrogen™ Human KCTD16 (aa 324-390) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | PQETVICGPVTRQTNIQTLDRPIKKGPVQLIQQSEMRRKSDLLRTLTSGSRESNMSSKKKAVKEKLS |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human KCTD16 (aa 324-390) Control Fragment |
Recombinant | Recombinant |