Chicken Whole Blood
Chicken Whole Blood
LAMPIRE Biological Laboratories CHICKEN BLOOD NA CITRATE 50ML
Chicken, Whole Blood, Na Citrate, Donor, Gender Unspecified, 50 Ml
Kingfisher Biotech Inc Bovine IL-1 RA - 10ug
The Bovine IL-1 Receptor Antagonist (IL-1ra) Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-1 Receptor Antagonist (IL-1ra) Biotinylated applications are for cell culture. Control. Bovine IL-1 Receptor Antagonist (IL-1ra) Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-1 Receptor Antagonist (IL-1ra) Biotinylated Specifications: (Molecular Weight: 17.2 kDa) (Amino Acid Sequence: HPLGKRRCEM QAFRIWDVNQ KIFYLRNNQL VAGYLQGPNT KLEEKIDVVP IEPHTMFLGI HGGKLCLACV KSGDEIKLKL EAVNITDLNQ NREQDKRFAF IRFDNGPTTS FESAACPGWF LCTSLEADQP VGLTNMPTEA LKVTKFYFQQ D (151)) (Gene ID: 281860). For research use only. Made in the USA
Kingfisher Biotech Inc Swine IL-4 Biotinylated - 10ug
The Swine IL-4 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine IL-4 Biotinylated applications are for cell culture. Control. Swine IL-4 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Swine IL-4 Biotinylated Specifications: (Molecular Weight: 12.5 kDa) (Amino Acid Sequence: HKCDITLQEI IKTLNILTAR KNSCMELPVT DVFAAPENTT EKETFCRAST VLRHIYRHHT CMKSLLSGLD RNLSSMANMT CSVHEAKKST LKDFLERLKT IMKEKYSKC (109)) (Gene ID: 397225). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken IFN gamma - 10ug
The Chicken IFN gamma Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken IFN gamma Biotinylated applications are for cell culture. Control. Chicken IFN gamma Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Chicken IFN gamma Biotinylated Specifications: (Molecular Weight: 16.7 kDa) (Amino Acid Sequence: HTASSLNLVQLQDDIDKLKADFNSSHSDVADGGPIIVEKLKNWTERNEKRIILSQIVSMYLEMLENTDKSKPHTKHISEELYTLKNNLPDGVKKVKDIMDLAKLPMNDLRIQRKAANELFSILQKLVDPPSFKRKRSQSQRRCNC) (Gene ID: 396054). For research use only. Made in the USA
Kingfisher Biotech Inc Bovine CXCL9 10ug
The Bovine CXCL9 (MIG) Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CXCL9 (MIG) Biotinylated applications are for cell culture. Control. Bovine CXCL9 (MIG) Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CXCL9 (MIG) Biotinylated Specifications: (Molecular Weight: 11.9 kDa) (Amino Acid Sequence: VPAIRNGRCS CINTSQGMIH PKSLKDLKQF APSPSCEKTE IIATMKNGNE ACLNPDLPEV KELIKEWEKQ VNQKKKQRKG KKYKKTKKVP KVKRSQRPSQ KKTT) (Gene ID: 513990). For research use only. Made in the USA
Kingfisher Biotech Inc Canine Neurophysin-1 - 500ug
The Canine Neurophysin-1 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine Neurophysin-1 applications are for cell culture, ELISA standard, and Western Blot Control. Canine Neurophysin-1 yeast-derived recombinant protein can be purchased in multiple sizes. Canine Neurophysin-1 Specifications: (Molecular Weight: 9.5 kDa) (Amino Acid Sequence AALDLDVRQC LPCGPGGQGR CFGPSICCGD ELGCFVGTAE ALRCQEENYL PSPCQSGRTP CGSGGRCAAA GICCSPDGCR ADPACDPDAA FSQR (94)) (Gene ID: 100856247). For research use only. Made in the USA
Kingfisher Biotech Inc Bat LIF - 5ug
The Jamaican fruit-eating Bat Leukemia Inhibitory Factor yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Jamaican fruit-eating Bat Leukemia Inhibitory Factor applications are for cell culture, ELISA standard, and Western Blot Control. Jamaican fruit-eating Bat Leukemia Inhibitory Factor yeast-derived recombinant protein can be purchased in multiple sizes. Jamaican fruit-eating Bat Leukemia Inhibitory Factor Specifications: (Molecular Weight: 19.9 kDa) (Amino Acid Sequence: TPLPITPVNA TCVTRHPCHS NVMNQIRNQL VQLNSSANAL FILYYTVQGE PFSNNLEKLC SPNVTDFPPF HANGTEKARL VELYRIAAYL GASLGNITRD QKTLSPHAIS LHSKLNATLD VMRGLLSNVL CRLCSKYHVA HVEVAYGPDT SGKDMFQKKK LGCQLLGKYK QVIAVLAQAF (180)) (Gene ID: 119055186). For research use only. Made in the USA
Kingfisher Biotech Inc Human CCL13 - 100ug
The Human CCL13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human CCL13 applications are for cell culture, ELISA standard, and Western Blot Control. Human CCL13 yeast-derived recombinant protein can be purchased in multiple sizes. Human CCL13 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPDALNVPST CCFTFSSKKI SLQRLKSYVI TTSRCPQKAV IFRTKLGKEI CADPKEKWVQ NYMKHLGRKA HTLKT (75)) (Gene ID: 6357). For research use only. Made in the USA
Kingfisher Biotech Inc Human CCL13 - 5ug
The Human CCL13 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Human CCL13 applications are for cell culture, ELISA standard, and Western Blot Control. Human CCL13 yeast-derived recombinant protein can be purchased in multiple sizes. Human CCL13 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPDALNVPST CCFTFSSKKI SLQRLKSYVI TTSRCPQKAV IFRTKLGKEI CADPKEKWVQ NYMKHLGRKA HTLKT (75)) (Gene ID: 6357). For research use only. Made in the USA
Kingfisher Biotech Inc Chicken TNFSF15 - 10ug
The Chicken TNFSF15 (TL1A; VEGI) Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Chicken TNFSF15 (TL1A; VEGI) Biotinylated applications are for cell culture. Control. Chicken TNFSF15 (TL1A; VEGI) Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Chicken TNFSF15 (TL1A; VEGI) Biotinylated Specifications: (Molecular Weight: 19.1 kDa) (Amino Acid Sequence: ERSSHFLKQRAVAAVTDTLPSAEKPRAHLTVKKQEPSSTTGSHLPILQWEDKRGLAFTKNNLSYSSNALVIPVSGDYYVYAQVTFRGPSDTSSKTSSVTAVITKVTDSYPEPTQLLTSTKTLSEERNNWFQPIYLGAVVSLEIGDKLMVNVSDIKLVDYTKEHKTFFGAFLL) (Gene ID: 417247). For research use only. Made in the USA
Kingfisher Biotech Inc Equine IL-5 - 10ug
The Equine IL-5 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Equine IL-5 Biotinylated applications are for cell culture. Control. Equine IL-5 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Equine IL-5 Biotinylated Specifications: (Molecular Weight: 12.9 kDa) (Amino Acid Sequence: AVESPMNRLVAETLTLLSTHRTLLIGDGNLMIPTPEHKNHQLCIEEVFQGIDTLKNQTVQGDAVAKLFQNLSLIKGYIDLQKKKCGGERWRVKQFLDYLQEFLGVINTEWTIEG) (Gene ID: 100034199). For research use only. Made in the USA
Kingfisher Biotech Inc Swine TNF alpha 10ug
The Swine TNF alpha Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Swine TNF alpha Biotinylated applications are for cell culture. Control. Swine TNF alpha Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Swine TNF alpha Biotinylated Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: SSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL) (Gene ID: 397086). For research use only. Made in the USA